Lineage for d5b8ic_ (5b8i C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1899919Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1899920Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1900227Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 1900228Protein automated matches [191162] (23 species)
    not a true protein
  7. 1900247Species Coccidioides immitis [TaxId:246410] [272842] (1 PDB entry)
  8. 1900248Domain d5b8ic_: 5b8i C: [272843]
    Other proteins in same PDB: d5b8ia_, d5b8ib_
    automated match to d1r9ha_
    complexed with ca, edo, fe, fk5, mes, zn

Details for d5b8ic_

PDB Entry: 5b8i (more details), 1.85 Å

PDB Description: crystal structure of calcineurin a and calcineurin b in complex with fkbp12 and fk506 from coccidioides immitis rs
PDB Compounds: (C:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d5b8ic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b8ic_ d.26.1.0 (C:) automated matches {Coccidioides immitis [TaxId: 246410]}
gvtkkilkegngvdkpvkgddivmnyrgclydsskpsehfmgrkfdsteergefktkigi
gvvirgwdeavlqmslgeksiltitddyaygargfpglipphatlvfevelkginskra

SCOPe Domain Coordinates for d5b8ic_:

Click to download the PDB-style file with coordinates for d5b8ic_.
(The format of our PDB-style files is described here.)

Timeline for d5b8ic_: