Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
Protein automated matches [191162] (23 species) not a true protein |
Species Coccidioides immitis [TaxId:246410] [272842] (1 PDB entry) |
Domain d5b8ic_: 5b8i C: [272843] Other proteins in same PDB: d5b8ia_, d5b8ib_ automated match to d1r9ha_ complexed with ca, edo, fe, fk5, mes, zn |
PDB Entry: 5b8i (more details), 1.85 Å
SCOPe Domain Sequences for d5b8ic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b8ic_ d.26.1.0 (C:) automated matches {Coccidioides immitis [TaxId: 246410]} gvtkkilkegngvdkpvkgddivmnyrgclydsskpsehfmgrkfdsteergefktkigi gvvirgwdeavlqmslgeksiltitddyaygargfpglipphatlvfevelkginskra
Timeline for d5b8ic_: