Class b: All beta proteins [48724] (180 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins) automatically mapped to Pfam PF02931 |
Protein automated matches [190922] (2 species) not a true protein |
Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (38 PDB entries) |
Domain d4zjtg1: 4zjt G:1-210 [272811] Other proteins in same PDB: d4zjta2, d4zjtb2, d4zjtc2, d4zjtd2, d4zjte2, d4zjtf2, d4zjtg2, d4zjth2, d4zjti2, d4zjtj2 automated match to d4alxa_ complexed with 4p6, po4 |
PDB Entry: 4zjt (more details), 1.85 Å
SCOPe Domain Sequences for d4zjtg1:
Sequence, based on SEQRES records: (download)
>d4zjtg1 b.96.1.1 (G:1-210) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk nsvtysccpeayedvevslnfrkkgrseil
>d4zjtg1 b.96.1.1 (G:1-210) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr fscdvsgvdtesgatcrikigswthhsreisvdpnsddseyfsqysrfeildvtqkknsv tysccpeayedvevslnfrkkgrseil
Timeline for d4zjtg1: