SCOPe 2.08: Domain d4zcje1: 4zcj E:11-324

Lineage for d4zcje1 (4zcj E:11-324)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (22 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)

8. Domain d4zcje1: 4zcj E:11-324 [272799]
   Other proteins in same PDB: d4zcja2, d4zcjb_, d4zcjc2, d4zcjd_, d4zcje2, d4zcjf_
   automated match to d3sdya_
   complexed with nag; mutant

Details for d4zcje1

PDB Entry: 4zcj, 3 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin ha1 cys30, ha2 cys47 mutant

PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4zcje1:

Sequence; same for both SEQRES and ATOM records:

>d4zcje1 b.19.1.2 (E:11-324) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
atlclghhavpngtlvkticddqievtnatelvqssstgkicnnphrildgidctlidal
lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv
tqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstnqe
qtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsngn
liaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpkyvk
qntlklatgmrnvp

Timeline for d4zcje1:

• d4zcje1 first appeared in SCOPe 2.05, called d4zcje_
  
• d4zcje1 appears in SCOPe 2.07