SCOPe 2.05: Domain d4xpbl1: 4xpb L:1-108

Lineage for d4xpbl1 (4xpb L:1-108)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [272437] (43 PDB entries)

8. Domain d4xpbl1: 4xpb L:1-108 [272776]
   Other proteins in same PDB: d4xpbl2
   automated match to d2i9la1
   complexed with cl, clr, coc, n9s, na; mutant

Details for d4xpbl1

PDB Entry: 4xpb, 3.05 Å

PDB Description: x-ray structure of drosophila dopamine transporter with subsiteb mutations (d121g/s426m) bound to cocaine

PDB Compounds: (L:) antibody fragment heavy chain-protein, 9d5-heavy chain

SCOPe Domain Sequences for d4xpbl1:

Sequence; same for both SEQRES and ATOM records:

>d4xpbl1 b.1.1.0 (L:1-108) automated matches {Mus musculus [TaxId: 10090]}
envltqspaimstspgekvtmtcrasssvgssylhwyqqksgaspklwiystsnlasgvp
arfsgsgsgtsysltissveaedaatyycqqfsgypltfgsgtklemk

Timeline for d4xpbl1:

• d4xpbl1 is new in SCOPe 2.05-stable
  
• d4xpbl1 appears in SCOPe 2.06
  
• d4xpbl1 appears in the current release, SCOPe 2.07