SCOPe 2.08: Domain d4u02b_: 4u02 B:

Lineage for d4u02b_ (4u02 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [272710] (21 PDB entries)

8. Domain d4u02b_: 4u02 B: [272719]
   automated match to d2oukb_
   complexed with so4

Details for d4u02b_

PDB Entry: 4u02, 2.4 Å

PDB Description: crystal structure of apo-ttha1159

PDB Compounds: (B:) Amino acid ABC transporter, ATP-binding protein

SCOPe Domain Sequences for d4u02b_:

Sequence; same for both SEQRES and ATOM records:

>d4u02b_ c.37.1.0 (B:) automated matches {Thermus thermophilus [TaxId: 300852]}
mepiirirnlhkwfgplhvlkgihlevapgeklviigpsgsgkstlirtinrledfqege
vvvdglsvkddralreirrevgmvfqqfnlfphmtvlenvtlapmrvrrwprekaekkal
ellervgildqarkypaqlsggqqqrvaiaralamepkimlfdeptsaldpemvgevldv
mrdlaqggmtmvvvthemgfarevadrvvfmdggqiveegrpeeiftrpkeertrsflqr
vlh

Timeline for d4u02b_:

• d4u02b_ first appeared in SCOPe 2.05
  
• d4u02b_ appears in SCOPe 2.07