Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (96 species) not a true protein |
Species Thermus thermophilus [TaxId:300852] [272710] (2 PDB entries) |
Domain d4u02d_: 4u02 D: [272717] automated match to d2oukb_ complexed with so4 |
PDB Entry: 4u02 (more details), 2.4 Å
SCOPe Domain Sequences for d4u02d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4u02d_ c.37.1.0 (D:) automated matches {Thermus thermophilus [TaxId: 300852]} epiirirnlhkwfgplhvlkgihlevapgeklviigpsgsgkstlirtinrledfqegev vvdglsvkddralreirrevgmvfqqfnlfphmtvlenvtlapmrvrrwprekaekkale llervgildqarkypaqlsggqqqrvaiaralamepkimlfdeptsaldpemvgevldvm rdlaqggmtmvvvthemgfarevadrvvfmdggqiveegrpeeiftrpkeertrsflqrv lh
Timeline for d4u02d_: