Lineage for d4u00a_ (4u00 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2873073Species Thermus thermophilus [TaxId:300852] [272710] (21 PDB entries)
  8. 2873106Domain d4u00a_: 4u00 A: [272715]
    automated match to d2oukb_
    complexed with adp, cl, mg

Details for d4u00a_

PDB Entry: 4u00 (more details), 2.1 Å

PDB Description: crystal structure of ttha1159 in complex with adp
PDB Compounds: (A:) Amino acid ABC transporter, ATP-binding protein

SCOPe Domain Sequences for d4u00a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u00a_ c.37.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 300852]}
piirirnlhkwfgplhvlkgihlevapgeklviigpsgsgkstlirtinrledfqegevv
vdglsvkddralreirrevgmvfqqfnlfphmtvlenvtlapmrvrrwprekaekkalel
lervgildqarkypaqlsggqqqrvaiaralamepkimlfdeptsaldpemvgevldvmr
dlaqggmtmvvvthemgfarevadrvvfmdggqiveegrpeeiftrpkeertrsflqrvl
h

SCOPe Domain Coordinates for d4u00a_:

Click to download the PDB-style file with coordinates for d4u00a_.
(The format of our PDB-style files is described here.)

Timeline for d4u00a_: