Lineage for d2rtbd_ (2rtb D:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 958655Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 958656Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 958657Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 958680Protein Streptavidin [50878] (1 species)
  7. 958681Species Streptomyces avidinii [TaxId:1895] [50879] (118 PDB entries)
  8. 958752Domain d2rtbd_: 2rtb D: [27271]
    complexed with act, cl, na

Details for d2rtbd_

PDB Entry: 2rtb (more details), 1.5 Å

PDB Description: apostreptavidin, ph 3.32, space group i222
PDB Compounds: (D:) streptavidin

SCOPe Domain Sequences for d2rtbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rtbd_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v

SCOPe Domain Coordinates for d2rtbd_:

Click to download the PDB-style file with coordinates for d2rtbd_.
(The format of our PDB-style files is described here.)

Timeline for d2rtbd_: