Lineage for d4qd8a_ (4qd8 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944535Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [272670] (6 PDB entries)
  8. 2944536Domain d4qd8a_: 4qd8 A: [272687]
    automated match to d2b6ef_
    complexed with 0fq

Details for d4qd8a_

PDB Entry: 4qd8 (more details), 1.62 Å

PDB Description: crystal structure of thioesterase pa1618 from pseudomonas aeruginosa in complex with phenacyl-coa
PDB Compounds: (A:) Thioesterase PA1618

SCOPe Domain Sequences for d4qd8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qd8a_ d.38.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
slwrqtpdleqlnasqknsigdllgirfeafddesltasmpvdsrthqpfgllhggasvv
laeslgsmasylcvdtsqyycvglevnanhlrglrsgrvtavaraihlgrtthvwdirls
gddgkpsciarltmavvpl

SCOPe Domain Coordinates for d4qd8a_:

Click to download the PDB-style file with coordinates for d4qd8a_.
(The format of our PDB-style files is described here.)

Timeline for d4qd8a_: