SCOPe 2.02: Domain d2izaa_: 2iza A:

Lineage for d2izaa_ (2iza A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (120 PDB entries)

8. Domain d2izaa_: 2iza A: [27260]
   complexed with fmt

Details for d2izaa_

PDB Entry: 2iza, 1.46 Å

PDB Description: apostreptavidin ph 2.00 i4122 structure

PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d2izaa_:

Sequence; same for both SEQRES and ATOM records:

>d2izaa_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v

Timeline for d2izaa_:

• d2izaa_ first appeared (with stable ids) in SCOP 1.55, called d2iza__
  
• d2izaa_ appears in SCOPe 2.01
  
• d2izaa_ appears in SCOPe 2.03
  
• d2izaa_ appears in the current release, SCOPe 2.08