SCOP 1.61: Domain d2rtl__: 2rtl -

Lineage for d2rtl__ (2rtl -)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.61: Streptavidin-like [50875] (5 superfamilies)

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (89 PDB entries)

8. Domain d2rtl__: 2rtl - [27256]

Details for d2rtl__

PDB Entry: 2rtl, 1.41 Å

PDB Description: streptavidin-2-iminobiotin-sulfate complex, ph 2.50, space group i4122

SCOP Domain Sequences for d2rtl__:

Sequence; same for both SEQRES and ATOM records:

>d2rtl__ b.61.1.1 (-) Streptavidin {Streptomyces avidinii}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

Timeline for d2rtl__:

• d2rtl__ first appeared (with stable ids) in SCOP 1.55
  
• d2rtl__ appears in SCOP 1.59
  
• d2rtl__ appears in SCOP 1.63
  
• d2rtl__ appears in the current release, SCOPe 2.08, called d2rtla_