SCOPe 2.08: Domain d4zg1d1: 4zg1 D:6-116

Lineage for d4zg1d1 (4zg1 D:6-116)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d4zg1d1: 4zg1 D:6-116 [272532]
   Other proteins in same PDB: d4zg1a2, d4zg1b2, d4zg1c2, d4zg1d2, d4zg1e2, d4zg1f2
   automated match to d3ezjb_

Details for d4zg1d1

PDB Entry: 4zg1, 1.85 Å

PDB Description: crystal structure of a nanobody raised against kdm5b

PDB Compounds: (D:) nb17

SCOPe Domain Sequences for d4zg1d1:

Sequence; same for both SEQRES and ATOM records:

>d4zg1d1 b.1.1.1 (D:6-116) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaasgstfgirtmgwyrqapgkqrdlvaiissggstdyadsvkg
rftisrdnakntvylqmdslkpedtaiyycnarvgitmlahwgqgtqvtvs

Timeline for d4zg1d1:

• d4zg1d1 first appeared in SCOPe 2.05, called d4zg1d_
  
• d4zg1d1 appears in SCOPe 2.07