Lineage for d2rtfb_ (2rtf B:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 170128Fold b.61: Streptavidin-like [50875] (5 superfamilies)
  4. 170129Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 170130Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 170145Protein Streptavidin [50878] (1 species)
  7. 170146Species Streptomyces avidinii [TaxId:1895] [50879] (89 PDB entries)
  8. 170171Domain d2rtfb_: 2rtf B: [27253]

Details for d2rtfb_

PDB Entry: 2rtf (more details), 1.47 Å

PDB Description: streptavidin-biotin complex, ph 2.00, space group i222

SCOP Domain Sequences for d2rtfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rtfb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

SCOP Domain Coordinates for d2rtfb_:

Click to download the PDB-style file with coordinates for d2rtfb_.
(The format of our PDB-style files is described here.)

Timeline for d2rtfb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2rtfd_