Lineage for d4ypga2 (4ypg A:108-215)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2752231Domain d4ypga2: 4ypg A:108-215 [272526]
    Other proteins in same PDB: d4ypga1, d4ypgb_, d4ypgc1, d4ypgc2, d4ypgd1, d4ypgd2, d4ypgh_, d4ypgl1
    automated match to d1dn0a2
    complexed with ni

Details for d4ypga2

PDB Entry: 4ypg (more details), 3 Å

PDB Description: structural insights into the neutralization properties of a human anti-interferon monoclonal antibody
PDB Compounds: (A:) Sifalimumab light chain

SCOPe Domain Sequences for d4ypga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ypga2 b.1.1.2 (A:108-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d4ypga2:

Click to download the PDB-style file with coordinates for d4ypga2.
(The format of our PDB-style files is described here.)

Timeline for d4ypga2: