Class b: All beta proteins [48724] (177 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) automatically mapped to Pfam PF02874 |
Family b.49.1.0: automated matches [254232] (1 protein) not a true family |
Protein automated matches [254527] (11 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [255270] (6 PDB entries) |
Domain d4yxwc1: 4yxw C:23-94 [272513] Other proteins in same PDB: d4yxwa2, d4yxwa3, d4yxwb2, d4yxwb3, d4yxwc2, d4yxwc3, d4yxwd2, d4yxwd3, d4yxwe2, d4yxwe3, d4yxwf2, d4yxwf3, d4yxwh1, d4yxwh2, d4yxwi_ automated match to d1maba2 complexed with anp, cl, mg, na, ts6 |
PDB Entry: 4yxw (more details), 3.1 Å
SCOPe Domain Sequences for d4yxwc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yxwc1 b.49.1.0 (C:23-94) automated matches {Cow (Bos taurus) [TaxId: 9913]} vdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndkli kegdivkrtgai
Timeline for d4yxwc1: