Class a: All alpha proteins [46456] (289 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) |
Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
Protein automated matches [254528] (11 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [255272] (6 PDB entries) |
Domain d4yxwd3: 4yxw D:358-475 [272509] Other proteins in same PDB: d4yxwa1, d4yxwa2, d4yxwb1, d4yxwb2, d4yxwc1, d4yxwc2, d4yxwd1, d4yxwd2, d4yxwe1, d4yxwe2, d4yxwf1, d4yxwf2, d4yxwh1, d4yxwh2, d4yxwi_ automated match to d1mabb1 complexed with anp, cl, mg, na, ts6 |
PDB Entry: 4yxw (more details), 3.1 Å
SCOPe Domain Sequences for d4yxwd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yxwd3 a.69.1.0 (D:358-475) automated matches {Cow (Bos taurus) [TaxId: 9913]} mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadklae
Timeline for d4yxwd3: