Lineage for d4yxwi_ (4yxw I:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016286Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2016449Superfamily a.137.8: Epsilon subunit of mitochondrial F1F0-ATP synthase [48690] (1 family) (S)
    automatically mapped to Pfam PF04627
  5. 2016450Family a.137.8.1: Epsilon subunit of mitochondrial F1F0-ATP synthase [48691] (2 proteins)
  6. 2016467Protein automated matches [190373] (2 species)
    not a true protein
  7. 2016470Species Cow (Bos taurus) [TaxId:9913] [187216] (5 PDB entries)
  8. 2016475Domain d4yxwi_: 4yxw I: [272497]
    Other proteins in same PDB: d4yxwa1, d4yxwa2, d4yxwa3, d4yxwb1, d4yxwb2, d4yxwb3, d4yxwc1, d4yxwc2, d4yxwc3, d4yxwd1, d4yxwd2, d4yxwd3, d4yxwe1, d4yxwe2, d4yxwe3, d4yxwf1, d4yxwf2, d4yxwf3, d4yxwh1, d4yxwh2
    automated match to d1e79i_
    complexed with anp, cl, mg, na, ts6

Details for d4yxwi_

PDB Entry: 4yxw (more details), 3.1 Å

PDB Description: bovine heart mitochondrial f1-atpase inhibited by amp-pnp and adp in the presence of thiophosphate.
PDB Compounds: (I:) ATP synthase subunit epsilon, mitochondrial

SCOPe Domain Sequences for d4yxwi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yxwi_ a.137.8.1 (I:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vaywrqaglsyirysqicakavrdalktefkanamktsgstikivkv

SCOPe Domain Coordinates for d4yxwi_:

Click to download the PDB-style file with coordinates for d4yxwi_.
(The format of our PDB-style files is described here.)

Timeline for d4yxwi_: