Lineage for d4ypgc1 (4ypg C:1-157)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705784Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
    contains an additional helix in one of the crossover connections
  6. 2705785Protein Interferon-alpha 2a [47314] (2 species)
  7. 2705786Species Human (Homo sapiens) [TaxId:9606] [47315] (9 PDB entries)
  8. 2705797Domain d4ypgc1: 4ypg C:1-157 [272489]
    Other proteins in same PDB: d4ypga1, d4ypga2, d4ypgb_, d4ypgc2, d4ypgd2, d4ypgh_, d4ypgl1, d4ypgl2
    automated match to d1itfa_
    complexed with ni

Details for d4ypgc1

PDB Entry: 4ypg (more details), 3 Å

PDB Description: structural insights into the neutralization properties of a human anti-interferon monoclonal antibody
PDB Compounds: (C:) Interferon alpha-2

SCOPe Domain Sequences for d4ypgc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ypgc1 a.26.1.3 (C:1-157) Interferon-alpha 2a {Human (Homo sapiens) [TaxId: 9606]}
cdlpqthslgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhemi
qqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsilavr
kyfqritlylkekkyspcawevvraeimrsfslstnl

SCOPe Domain Coordinates for d4ypgc1:

Click to download the PDB-style file with coordinates for d4ypgc1.
(The format of our PDB-style files is described here.)

Timeline for d4ypgc1: