Class a: All alpha proteins [46456] (290 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins) contains an additional helix in one of the crossover connections |
Protein Interferon-alpha 2a [47314] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47315] (9 PDB entries) |
Domain d4ypgc1: 4ypg C:1-157 [272489] Other proteins in same PDB: d4ypga1, d4ypga2, d4ypgb_, d4ypgc2, d4ypgd2, d4ypgh_, d4ypgl1, d4ypgl2 automated match to d1itfa_ complexed with ni |
PDB Entry: 4ypg (more details), 3 Å
SCOPe Domain Sequences for d4ypgc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ypgc1 a.26.1.3 (C:1-157) Interferon-alpha 2a {Human (Homo sapiens) [TaxId: 9606]} cdlpqthslgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhemi qqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsilavr kyfqritlylkekkyspcawevvraeimrsfslstnl
Timeline for d4ypgc1: