SCOPe 2.06: Domain d4ypgd1: 4ypg D:1-159

Lineage for d4ypgd1 (4ypg D:1-159)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interferon-alpha 2a [47314] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47315] (9 PDB entries)

8. Domain d4ypgd1: 4ypg D:1-159 [272488]
   Other proteins in same PDB: d4ypga1, d4ypga2, d4ypgc2, d4ypgd2, d4ypgl1, d4ypgl2
   automated match to d1itfa_
   complexed with ni

Details for d4ypgd1

PDB Entry: 4ypg, 3 Å

PDB Description: structural insights into the neutralization properties of a human anti-interferon monoclonal antibody

PDB Compounds: (D:) Interferon alpha-2

SCOPe Domain Sequences for d4ypgd1:

Sequence; same for both SEQRES and ATOM records:

>d4ypgd1 a.26.1.3 (D:1-159) Interferon-alpha 2a {Human (Homo sapiens) [TaxId: 9606]}
cdlpqthslgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhemi
qqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsilavr
kyfqritlylkekkyspcawevvraeimrsfslstnlqe

Timeline for d4ypgd1:

• d4ypgd1 first appeared in SCOPe 2.05, called d4ypgd_
  
• d4ypgd1 appears in SCOPe 2.07
  
• d4ypgd1 appears in the current release, SCOPe 2.08