Lineage for d4yfca2 (4yfc A:122-236)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2034475Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)
  8. 2035371Domain d4yfca2: 4yfc A:122-236 [272484]
    automated match to d2yd7b2
    complexed with bma, ful, nag

Details for d4yfca2

PDB Entry: 4yfc (more details), 2.7 Å

PDB Description: crystal structure of ptp delta ig1-ig2 in complex with il1rapl1
PDB Compounds: (A:) Receptor-type tyrosine-protein phosphatase delta

SCOPe Domain Sequences for d4yfca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yfca2 b.1.1.0 (A:122-236) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vlredqiprgfptidmgpqlkvvertrtatmlcaasgnpdpeitwfkdflpvdtsnnngr
ikqlrsesiggtpirgalqieqseesdqgkyecvatnsagtrysapanlyvrelr

SCOPe Domain Coordinates for d4yfca2:

Click to download the PDB-style file with coordinates for d4yfca2.
(The format of our PDB-style files is described here.)

Timeline for d4yfca2: