SCOPe 2.05: Domain d4yfca1: 4yfc A:28-121

Lineage for d4yfca1 (4yfc A:28-121)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [272437] (43 PDB entries)

8. Domain d4yfca1: 4yfc A:28-121 [272483]
   automated match to d2yd6a1
   complexed with bma, ful, nag

Details for d4yfca1

PDB Entry: 4yfc, 2.7 Å

PDB Description: crystal structure of ptp delta ig1-ig2 in complex with il1rapl1

PDB Compounds: (A:) Receptor-type tyrosine-protein phosphatase delta

SCOPe Domain Sequences for d4yfca1:

Sequence; same for both SEQRES and ATOM records:

>d4yfca1 b.1.1.0 (A:28-121) automated matches {Mus musculus [TaxId: 10090]}
etpprftrtpvdqtgvsggvasficqatgdprpkivwnkkgkkvsnqrfeviefddgsgs
vlriqplrtprdeaiyecvasnnvgeisvstrlt

Timeline for d4yfca1:

• d4yfca1 is new in SCOPe 2.05-stable
  
• d4yfca1 last appears in SCOPe 2.06