Lineage for d2izlb_ (2izl B:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 170128Fold b.61: Streptavidin-like [50875] (5 superfamilies)
  4. 170129Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 170130Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 170145Protein Streptavidin [50878] (1 species)
  7. 170146Species Streptomyces avidinii [TaxId:1895] [50879] (89 PDB entries)
  8. 170155Domain d2izlb_: 2izl B: [27245]

Details for d2izlb_

PDB Entry: 2izl (more details), 1.48 Å

PDB Description: streptavidin-2-iminobiotin ph 7.3 i222 complex

SCOP Domain Sequences for d2izlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2izlb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vk

SCOP Domain Coordinates for d2izlb_:

Click to download the PDB-style file with coordinates for d2izlb_.
(The format of our PDB-style files is described here.)

Timeline for d2izlb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2izld_