SCOPe 2.05: Domain d4xphl1: 4xph L:1-108

Lineage for d4xphl1 (4xph L:1-108)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [272437] (43 PDB entries)

8. Domain d4xphl1: 4xph L:1-108 [272445]
   Other proteins in same PDB: d4xphl2
   automated match to d2g2ra1
   complexed with 42j, cl, clr, n9s, na, p4g; mutant

Details for d4xphl1

PDB Entry: 4xph, 2.9 Å

PDB Description: x-ray structure of drosophila dopamine transporter with subsiteb mutations (d121g/s426m) bound to 3,4dichlorophenethylamine

PDB Compounds: (L:) Antibody fragment Light chain

SCOPe Domain Sequences for d4xphl1:

Sequence; same for both SEQRES and ATOM records:

>d4xphl1 b.1.1.0 (L:1-108) automated matches {Mus musculus [TaxId: 10090]}
envltqspaimstspgekvtmtcrasssvgssylhwyqqksgaspklwiystsnlasgvp
arfsgsgsgtsysltissveaedaatyycqqfsgypltfgsgtklemk

Timeline for d4xphl1:

• d4xphl1 is new in SCOPe 2.05-stable
  
• d4xphl1 appears in SCOPe 2.06
  
• d4xphl1 appears in the current release, SCOPe 2.07