Lineage for d4xp9l2 (4xp9 L:109-213)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1764241Species Mus musculus [TaxId:10090] [272441] (35 PDB entries)
  8. 1764279Domain d4xp9l2: 4xp9 L:109-213 [272442]
    Other proteins in same PDB: d4xp9l1
    automated match to d1f3dj2
    complexed with 1we, cl, clr, mal, mpo, na, nag, p4g, y01

Details for d4xp9l2

PDB Entry: 4xp9 (more details), 2.8 Å

PDB Description: x-ray structure of drosophila dopamine transporter bound to psychostimulant d-amphetamine
PDB Compounds: (L:) antibody fragment heavy chain-protein, 9d5-heavy chain

SCOPe Domain Sequences for d4xp9l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xp9l2 b.1.1.2 (L:109-213) automated matches {Mus musculus [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkiegserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d4xp9l2:

Click to download the PDB-style file with coordinates for d4xp9l2.
(The format of our PDB-style files is described here.)

Timeline for d4xp9l2: