Lineage for d4qafd_ (4qaf D:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1963384Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 1963385Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 1963386Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. 1963454Protein automated matches [190290] (1 species)
    not a true protein
  7. 1963455Species Human (Homo sapiens) [TaxId:9606] [187095] (8 PDB entries)
  8. 1963458Domain d4qafd_: 4qaf D: [272368]
    automated match to d1katv_
    complexed with act, oma, so4

Details for d4qafd_

PDB Entry: 4qaf (more details), 1.8 Å

PDB Description: crystal structure of an engineered lipocalin (anticalin) in complex with vegf(8-109)
PDB Compounds: (D:) Vascular Endothelial Growth Factor A

SCOPe Domain Sequences for d4qafd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qafd_ g.17.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpt
eesnitmqimrikphqgqhigemsflqhnkcecrp

SCOPe Domain Coordinates for d4qafd_:

Click to download the PDB-style file with coordinates for d4qafd_.
(The format of our PDB-style files is described here.)

Timeline for d4qafd_: