Lineage for d4qafc_ (4qaf C:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260390Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2260391Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2260392Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. 2260404Protein Vascular endothelial growth factor, VEGF [57505] (3 species)
  7. 2260407Species Human (Homo sapiens) [TaxId:9606] [57506] (20 PDB entries)
    Uniprot P15692 40-133
  8. 2260421Domain d4qafc_: 4qaf C: [272367]
    automated match to d1katv_
    complexed with act, oma, so4

Details for d4qafc_

PDB Entry: 4qaf (more details), 1.8 Å

PDB Description: crystal structure of an engineered lipocalin (anticalin) in complex with vegf(8-109)
PDB Compounds: (C:) Vascular Endothelial Growth Factor A

SCOPe Domain Sequences for d4qafc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qafc_ g.17.1.1 (C:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpkk

SCOPe Domain Coordinates for d4qafc_:

Click to download the PDB-style file with coordinates for d4qafc_.
(The format of our PDB-style files is described here.)

Timeline for d4qafc_: