SCOPe 2.05: Domain d4qafc_: 4qaf C:

Lineage for d4qafc_ (4qaf C:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)

6. Protein automated matches [190290] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187095] (8 PDB entries)

8. Domain d4qafc_: 4qaf C: [272367]
   automated match to d1katv_
   complexed with act, oma, so4

Details for d4qafc_

PDB Entry: 4qaf, 1.8 Å

PDB Description: crystal structure of an engineered lipocalin (anticalin) in complex with vegf(8-109)

PDB Compounds: (C:) Vascular Endothelial Growth Factor A

SCOPe Domain Sequences for d4qafc_:

Sequence; same for both SEQRES and ATOM records:

>d4qafc_ g.17.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpkk

Timeline for d4qafc_:

• d4qafc_ is new in SCOPe 2.05-stable
  
• d4qafc_ appears in SCOPe 2.06
  
• d4qafc_ appears in the current release, SCOPe 2.08