Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (54 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [272349] (5 PDB entries) |
Domain d4q1kb_: 4q1k B: [272359] Other proteins in same PDB: d4q1ka2 automated match to d2q34a_ complexed with gol, po4 |
PDB Entry: 4q1k (more details), 1.75 Å
SCOPe Domain Sequences for d4q1kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q1kb_ c.14.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 224308]} mthsvvelieiesaiiqvkmqdrthknafsqeltddliqafeyirqnpkykaviltgydn yfasggtqegllriqqgltkftddnlyslaldceipviaamqghgigggfvmglfadivi lsresvytanfmkygftpgmgatfivpkklgfslaqeillnagsyrgadlekrgvpfkvl praevldyavelaqelaekprnslvtlkdhlvaplrdqlprvieqelmmheatfhheevk srikgly
Timeline for d4q1kb_: