Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.43: EF-Ts domain-like [54712] (2 superfamilies) beta(2)-alpha(n)-beta; 2 layers a/b; antiparallel sheet: 123 |
Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family) comprises two structural repeats of this fold |
Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (1 protein) |
Protein Elongation factor Ts (EF-Ts), dimerisation domain [63422] (3 species) |
Species Escherichia coli [TaxId:562] [54716] (6 PDB entries) duplication: consists of two subdomains of this fold |
Domain d4pc2d3: 4pc2 D:140-280 [272333] Other proteins in same PDB: d4pc2a1, d4pc2a2, d4pc2a3, d4pc2b1, d4pc2b2, d4pc2b3, d4pc2c1, d4pc2d1 automated match to d1efub2 complexed with cl, gdp, gol |
PDB Entry: 4pc2 (more details), 2.2 Å
SCOPe Domain Sequences for d4pc2d3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pc2d3 d.43.1.1 (D:140-280) Elongation factor Ts (EF-Ts), dimerisation domain {Escherichia coli [TaxId: 562]} dvlgsyqhgarigvlvaakgadeelvkhiamhvaaskpefikpedvsaevvekeyqvqld iamqsgkpkeiaekmvegrmkkftgevsltgqpfvmepsktvgqllkehnaevtgfirfe vgegiekvetdfaaevaamsk
Timeline for d4pc2d3: