Lineage for d4pc3a1 (4pc3 A:8-204)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2125254Protein automated matches [190047] (29 species)
    not a true protein
  7. 2125334Species Escherichia coli [TaxId:83333] [272301] (1 PDB entry)
  8. 2125335Domain d4pc3a1: 4pc3 A:8-204 [272310]
    Other proteins in same PDB: d4pc3a2, d4pc3a3, d4pc3b2, d4pc3b3, d4pc3c1, d4pc3c2, d4pc3c3, d4pc3d1, d4pc3d2, d4pc3d3
    automated match to d1d8ta3
    complexed with gdp, gol

Details for d4pc3a1

PDB Entry: 4pc3 (more details), 1.83 Å

PDB Description: elongation factor tu:ts complex with partially bound gdp
PDB Compounds: (A:) Elongation factor Tu 1

SCOPe Domain Sequences for d4pc3a1:

Sequence, based on SEQRES records: (download)

>d4pc3a1 c.37.1.8 (A:8-204) automated matches {Escherichia coli [TaxId: 83333]}
tkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshv
eydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgv
pyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweak
ilelagfldsyipeper

Sequence, based on observed residues (ATOM records): (download)

>d4pc3a1 c.37.1.8 (A:8-204) automated matches {Escherichia coli [TaxId: 83333]}
tkphvnvgtighvdhgkttltaaittvlaktyggshveydtptrhyahvdcpghadyvkn
mitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvddeellelve
mevrellsqydfpgddtpivrgsalkalegdaeweakilelagfldsyipeper

SCOPe Domain Coordinates for d4pc3a1:

Click to download the PDB-style file with coordinates for d4pc3a1.
(The format of our PDB-style files is described here.)

Timeline for d4pc3a1: