Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (29 species) not a true protein |
Species Escherichia coli [TaxId:83333] [272301] (1 PDB entry) |
Domain d4pc3a1: 4pc3 A:8-204 [272310] Other proteins in same PDB: d4pc3a2, d4pc3a3, d4pc3b2, d4pc3b3, d4pc3c1, d4pc3c2, d4pc3c3, d4pc3d1, d4pc3d2, d4pc3d3 automated match to d1d8ta3 complexed with gdp, gol |
PDB Entry: 4pc3 (more details), 1.83 Å
SCOPe Domain Sequences for d4pc3a1:
Sequence, based on SEQRES records: (download)
>d4pc3a1 c.37.1.8 (A:8-204) automated matches {Escherichia coli [TaxId: 83333]} tkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshv eydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgv pyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweak ilelagfldsyipeper
>d4pc3a1 c.37.1.8 (A:8-204) automated matches {Escherichia coli [TaxId: 83333]} tkphvnvgtighvdhgkttltaaittvlaktyggshveydtptrhyahvdcpghadyvkn mitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvddeellelve mevrellsqydfpgddtpivrgsalkalegdaeweakilelagfldsyipeper
Timeline for d4pc3a1: