Lineage for d4pc3b3 (4pc3 B:297-393)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2793864Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793865Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2793974Family b.44.1.0: automated matches [254194] (1 protein)
    not a true family
  6. 2793975Protein automated matches [254425] (18 species)
    not a true protein
  7. 2794007Species Escherichia coli [TaxId:83333] [272305] (1 PDB entry)
  8. 2794009Domain d4pc3b3: 4pc3 B:297-393 [272306]
    Other proteins in same PDB: d4pc3a1, d4pc3a2, d4pc3b1, d4pc3b2, d4pc3c1, d4pc3c2, d4pc3c3, d4pc3d1, d4pc3d2, d4pc3d3
    automated match to d1d8ta2
    complexed with gdp, gol

Details for d4pc3b3

PDB Entry: 4pc3 (more details), 1.83 Å

PDB Description: elongation factor tu:ts complex with partially bound gdp
PDB Compounds: (B:) Elongation factor Tu 1

SCOPe Domain Sequences for d4pc3b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pc3b3 b.44.1.0 (B:297-393) automated matches {Escherichia coli [TaxId: 83333]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvlg

SCOPe Domain Coordinates for d4pc3b3:

Click to download the PDB-style file with coordinates for d4pc3b3.
(The format of our PDB-style files is described here.)

Timeline for d4pc3b3: