Class b: All beta proteins [48724] (176 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
Protein automated matches [226946] (19 species) not a true protein |
Species Escherichia coli [TaxId:83333] [272303] (1 PDB entry) |
Domain d4pc3b2: 4pc3 B:205-296 [272304] Other proteins in same PDB: d4pc3a1, d4pc3a3, d4pc3b1, d4pc3b3, d4pc3c1, d4pc3c2, d4pc3c3, d4pc3d1, d4pc3d2, d4pc3d3 automated match to d1efca1 complexed with gdp, gol |
PDB Entry: 4pc3 (more details), 1.83 Å
SCOPe Domain Sequences for d4pc3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pc3b2 b.43.3.0 (B:205-296) automated matches {Escherichia coli [TaxId: 83333]} aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl ldegragenvgvllrgikreeiergqvlakpg
Timeline for d4pc3b2: