Lineage for d4onla_ (4onl A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898312Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1898313Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1898314Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1898322Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1898383Species Human (Homo sapiens), E2 variant 1 [TaxId:9606] [143051] (6 PDB entries)
    Uniprot Q13404 80-221! Uniprot Q13404 82-220
  8. 1898385Domain d4onla_: 4onl A: [272277]
    Other proteins in same PDB: d4onlb_
    automated match to d2c2vc1

Details for d4onla_

PDB Entry: 4onl (more details), 1.35 Å

PDB Description: crystal structure of human mms2/ubc13_d81n, r85s, a122v, n123p
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 variant 2

SCOPe Domain Sequences for d4onla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4onla_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]}
gvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriysl
kvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrl
mmskenmklpqppegqtynn

SCOPe Domain Coordinates for d4onla_:

Click to download the PDB-style file with coordinates for d4onla_.
(The format of our PDB-style files is described here.)

Timeline for d4onla_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4onlb_