Lineage for d4nhua1 (4nhu A:2-112)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2034475Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)
  8. 2035400Domain d4nhua1: 4nhu A:2-112 [272271]
    Other proteins in same PDB: d4nhua2, d4nhuc2
    automated match to d2f54d1

Details for d4nhua1

PDB Entry: 4nhu (more details), 2.9 Å

PDB Description: the m33 tcr p3m33l/h-2 ld complex
PDB Compounds: (A:) 2C m33 alpha VmCh chimera

SCOPe Domain Sequences for d4nhua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nhua1 b.1.1.0 (A:2-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
svtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqlllkyysgdpvvqgvng
feaefsksnssfhlrkasvhwsdsavyfcavslhrpaltfgsgtkvivlpn

SCOPe Domain Coordinates for d4nhua1:

Click to download the PDB-style file with coordinates for d4nhua1.
(The format of our PDB-style files is described here.)

Timeline for d4nhua1: