SCOPe 2.05: Domain d4nhuc2: 4nhu C:113-200

Lineage for d4nhuc2 (4nhu C:113-200)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (14 species)
not a true protein
Species Mus musculus, [TaxId:10090] [272267] (3 PDB entries)
Domain d4nhuc2: 4nhu C:113-200 [272268]
Other proteins in same PDB: d4nhua1, d4nhub1, d4nhub2, d4nhuc1, d4nhud1, d4nhud2
automated match to d2f54d2

Details for d4nhuc2

PDB Entry: 4nhu (more details), 2.9 Å

PDB Description: the m33 tcr p3m33l/h-2 ld complex

PDB Compounds: (C:) 2C m33 alpha VmCh chimera

SCOPe Domain Sequences for d4nhuc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nhuc2 b.1.1.2 (C:113-200) automated matches {Mus musculus, [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

SCOPe Domain Coordinates for d4nhuc2:

Click to download the PDB-style file with coordinates for d4nhuc2.
(The format of our PDB-style files is described here.)

Timeline for d4nhuc2: