Class b: All beta proteins [48724] (180 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.9: Peptidylarginine deiminase Pad4, middle domain [110083] (2 families) automatically mapped to Pfam PF08527 |
Family b.2.9.0: automated matches [272207] (1 protein) not a true family |
Protein automated matches [272208] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [272209] (26 PDB entries) |
Domain d4n28a2: 4n28 A:116-294 [272257] Other proteins in same PDB: d4n28a1, d4n28a3, d4n28a4 automated match to d2dexx1 complexed with act, ca, mpd |
PDB Entry: 4n28 (more details), 1.88 Å
SCOPe Domain Sequences for d4n28a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n28a2 b.2.9.0 (A:116-294) automated matches {Human (Homo sapiens) [TaxId: 9606]} ieisldvdadrdgvveknnpkkaswtwgpegqgaillvncdretpwlpkedcrdekvysk edlkdmsqmilrtkgpdrlpagyeivlyismsdsdkvgvfyvenpffgqryihilgrrkl yhvvkytggsaellffveglcfpdegfsglvsihvslleymaqdipltpiftdtvifri
Timeline for d4n28a2: