Lineage for d4n2ka2 (4n2k A:116-294)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1771693Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1772650Superfamily b.2.9: Peptidylarginine deiminase Pad4, middle domain [110083] (2 families) (S)
    automatically mapped to Pfam PF08527
  5. 1772667Family b.2.9.0: automated matches [272207] (1 protein)
    not a true family
  6. 1772668Protein automated matches [272208] (1 species)
    not a true protein
  7. 1772669Species Homo sapiens [TaxId:9606] [272209] (19 PDB entries)
  8. 1772670Domain d4n2ka2: 4n2k A:116-294 [272235]
    Other proteins in same PDB: d4n2ka1, d4n2ka3
    automated match to d2dexx1
    complexed with ca, gol, mpd

Details for d4n2ka2

PDB Entry: 4n2k (more details), 1.57 Å

PDB Description: crystal structure of protein arginine deiminase 2 (q350a, 0 mm ca2+)
PDB Compounds: (A:) Protein-arginine deiminase type-2

SCOPe Domain Sequences for d4n2ka2:

Sequence, based on SEQRES records: (download)

>d4n2ka2 b.2.9.0 (A:116-294) automated matches {Homo sapiens [TaxId: 9606]}
ieisldvdadrdgvveknnpkkaswtwgpegqgaillvncdretpwlpkedcrdekvysk
edlkdmsqmilrtkgpdrlpagyeivlyismsdsdkvgvfyvenpffgqryihilgrrkl
yhvvkytggsaellffveglcfpdegfsglvsihvslleymaqdipltpiftdtvifri

Sequence, based on observed residues (ATOM records): (download)

>d4n2ka2 b.2.9.0 (A:116-294) automated matches {Homo sapiens [TaxId: 9606]}
ieisldvdadrdgvveknnpkkaswtwgpegqgaillvncdvyskedlkdmsqmilrtkg
pdrlpagyeivlyismsdsdkvgvfyvenpffgqryihilgrrklyhvvkytggsaellf
fveglcfpdegfsglvsihvslleymaqdipltpiftdtvifri

SCOPe Domain Coordinates for d4n2ka2:

Click to download the PDB-style file with coordinates for d4n2ka2.
(The format of our PDB-style files is described here.)

Timeline for d4n2ka2: