SCOPe 2.07: Domain d4n2fa2: 4n2f A:116-294

Lineage for d4n2fa2 (4n2f A:116-294)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.9: Peptidylarginine deiminase Pad4, middle domain [110083] (2 families)
   automatically mapped to Pfam PF08527

5. Family b.2.9.0: automated matches [272207] (1 protein)
   not a true family

6. Protein automated matches [272208] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [272209] (26 PDB entries)

8. Domain d4n2fa2: 4n2f A:116-294 [272215]
   Other proteins in same PDB: d4n2fa1, d4n2fa3, d4n2fa4
   automated match to d2dexx1
   complexed with act, ca, mpd

Details for d4n2fa2

PDB Entry: 4n2f, 1.8 Å

PDB Description: crystal structure of protein arginine deiminase 2 (d169a, 0 mm ca2+)

PDB Compounds: (A:) Protein-arginine deiminase type-2

SCOPe Domain Sequences for d4n2fa2:

Sequence, based on SEQRES records:

>d4n2fa2 b.2.9.0 (A:116-294) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ieisldvdadrdgvveknnpkkaswtwgpegqgaillvncdretpwlpkedcraekvysk
edlkdmsqmilrtkgpdrlpagyeivlyismsdsdkvgvfyvenpffgqryihilgrrkl
yhvvkytggsaellffveglcfpdegfsglvsihvslleymaqdipltpiftdtvifri

Sequence, based on observed residues (ATOM records):

>d4n2fa2 b.2.9.0 (A:116-294) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ieisldvdadrdgvveknnpkkaswtwgpegqgaillvncdlkdmsqmilrtkgpdrlpa
gyeivlyismsdsdkvgvfyvenpffgqryihilgrrklyhvvkytggsaellffveglc
fpdegfsglvsihvslleymaqdipltpiftdtvifri

Timeline for d4n2fa2:

• d4n2fa2 first appeared in SCOPe 2.05
  
• d4n2fa2 appears in SCOPe 2.06
  
• d4n2fa2 appears in the current release, SCOPe 2.08