SCOPe 2.07: Domain d4n2fa1: 4n2f A:2-115

Lineage for d4n2fa1 (4n2f A:2-115)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188940] (31 PDB entries)

8. Domain d4n2fa1: 4n2f A:2-115 [272214]
   Other proteins in same PDB: d4n2fa2, d4n2fa3, d4n2fa4
   automated match to d2dexx2
   complexed with act, ca, mpd

Details for d4n2fa1

PDB Entry: 4n2f, 1.8 Å

PDB Description: crystal structure of protein arginine deiminase 2 (d169a, 0 mm ca2+)

PDB Compounds: (A:) Protein-arginine deiminase type-2

SCOPe Domain Sequences for d4n2fa1:

Sequence; same for both SEQRES and ATOM records:

>d4n2fa1 b.6.1.0 (A:2-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lrertvrlqygsrveavyvlgtylwtdvysaapagaqtfslkhsehvwvevvrdgeaeev
atngkqrwllspsttlrvtmsqasteassdkvtvnyydeegsipidqaglflta

Timeline for d4n2fa1:

• d4n2fa1 first appeared in SCOPe 2.05
  
• d4n2fa1 appears in SCOPe 2.06
  
• d4n2fa1 appears in the current release, SCOPe 2.08