Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (132 species) not a true protein |
Species Escherichia coli [TaxId:83333] [272137] (17 PDB entries) |
Domain d5a1ab3: 5a1a B:334-625 [272156] Other proteins in same PDB: d5a1aa1, d5a1aa2, d5a1aa4, d5a1aa5, d5a1ab1, d5a1ab2, d5a1ab4, d5a1ab5, d5a1ac1, d5a1ac2, d5a1ac4, d5a1ac5, d5a1ad1, d5a1ad2, d5a1ad4, d5a1ad5 automated match to d1jz7a5 complexed with mg, na, ptq |
PDB Entry: 5a1a (more details), 2.2 Å
SCOPe Domain Sequences for d5a1ab3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a1ab3 c.1.8.0 (B:334-625) automated matches {Escherichia coli [TaxId: 83333]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d5a1ab3:
View in 3D Domains from same chain: (mouse over for more information) d5a1ab1, d5a1ab2, d5a1ab4, d5a1ab5 |