Lineage for d5afkb_ (5afk B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819475Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2819476Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2819945Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2819946Protein automated matches [193506] (5 species)
    not a true protein
  7. 2820444Species Human (Homo sapiens) [TaxId:9606] [259757] (10 PDB entries)
  8. 2820459Domain d5afkb_: 5afk B: [272127]
    automated match to d4uxua_
    complexed with 5vu, gol, l0b

Details for d5afkb_

PDB Entry: 5afk (more details), 2.38 Å

PDB Description: alpha7-achbp in complex with lobeline and fragment 2
PDB Compounds: (B:) acetylcholine-binding protein, neuronal acetylcholine receptor subunit alpha-7

SCOPe Domain Sequences for d5afkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5afkb_ b.96.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt
dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi
rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
serfyecckepypdvtftvtfrkkg

SCOPe Domain Coordinates for d5afkb_:

Click to download the PDB-style file with coordinates for d5afkb_.
(The format of our PDB-style files is described here.)

Timeline for d5afkb_: