Class b: All beta proteins [48724] (180 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins) automatically mapped to Pfam PF02931 |
Protein automated matches [190922] (2 species) not a true protein |
Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (38 PDB entries) |
Domain d5afnd_: 5afn D: [272123] automated match to d1uw6a_ complexed with bma, gol, l0b, man, nag, ojd |
PDB Entry: 5afn (more details), 2.15 Å
SCOPe Domain Sequences for d5afnd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5afnd_ b.96.1.1 (D:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr serfyecckepypdvtftvtfrkkg
Timeline for d5afnd_:
View in 3D Domains from other chains: (mouse over for more information) d5afna_, d5afnb_, d5afnc_, d5afne_ |