SCOPe 2.08: Domain d1cbia_: 1cbi A:

Lineage for d1cbia_ (1cbi A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)

7. Species Cow and mouse (Bos taurus) and (Mus musculus), CRABP-I, identical sequences [TaxId:9913] [50863] (3 PDB entries)

8. Domain d1cbia_: 1cbi A: [27209]

Details for d1cbia_

PDB Entry: 1cbi, 2.7 Å

PDB Description: apo-cellular retinoic acid binding protein i

PDB Compounds: (A:) cellular retinoic acid binding protein I

SCOPe Domain Sequences for d1cbia_:

Sequence; same for both SEQRES and ATOM records:

>d1cbia_ b.60.1.2 (A:) Cellular retinoic-acid-binding protein (CRABP) {Cow and mouse (Bos taurus) and (Mus musculus), CRABP-I, identical sequences [TaxId: 9913]}
pnfagtwkmrssenfdellkalgvnamlrkvavaaaskphveirqdgdqfyiktsttvrt
teinfkvgegfeeetvdgrkcrslptwenenkihctqtllegdgpktywtrelandelil
tfgaddvvctriyvre

Timeline for d1cbia_:

• d1cbia_ first appeared (with stable ids) in SCOP 1.55
  
• d1cbia_ appears in SCOPe 2.07