SCOPe 2.08: Domain d1xcab_: 1xca B:

Lineage for d1xcab_ (1xca B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)

7. Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (76 PDB entries)

8. Domain d1xcab_: 1xca B: [27206]

Details for d1xcab_

PDB Entry: 1xca, 2.3 Å

PDB Description: apo-cellular retinoic acid binding protein ii

PDB Compounds: (B:) cellular retinoic acid binding protein type II

SCOPe Domain Sequences for d1xcab_:

Sequence; same for both SEQRES and ATOM records:

>d1xcab_ b.60.1.2 (B:) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]}
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtmeltndgeli
ltmtaddvvctrvyvre

Timeline for d1xcab_:

• d1xcab_ first appeared (with stable ids) in SCOP 1.55
  
• d1xcab_ appears in SCOPe 2.07