Lineage for d4y0mj1 (4y0m J:88-301)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916002Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196922] (8 PDB entries)
  8. 2916026Domain d4y0mj1: 4y0m J:88-301 [272035]
    Other proteins in same PDB: d4y0ma2, d4y0mc2, d4y0md2, d4y0mg2, d4y0mh2, d4y0mi2, d4y0mj2, d4y0ml2
    automated match to d1i6aa_

Details for d4y0mj1

PDB Entry: 4y0m (more details), 2.3 Å

PDB Description: the reduced form of oxyr regulatory domain from psedomonas aeruginosa
PDB Compounds: (J:) OxyR

SCOPe Domain Sequences for d4y0mj1:

Sequence, based on SEQRES records: (download)

>d4y0mj1 c.94.1.0 (J:88-301) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
qlaaplkvgaiytigpylfphlipqlhrvapqmplyieenfthilrdklrtgeldaiiia
lpfqeadvltkplfdepfyvlmpadhpwtakasidsellndksllllgeghcfrdqvlea
cptvrkgdenkhttvesssletirhmvasglgvsvlpfsavdshhyapgvievrpfsapv
pfrtvaiawrasfprpraievladsirlcsvarp

Sequence, based on observed residues (ATOM records): (download)

>d4y0mj1 c.94.1.0 (J:88-301) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
qlaaplkvgaiytigpylfphlipqlhrvapqmplyieenfthilrdklrtgeldaiiia
lpfqeadvltkplfdepfyvlmpadhpwtakasidsellndksllllgeghcfrdqvlea
cptvkhttvesssletirhmvasglgvsvlpfsavdshhyapgvievrpfsapvpfrtva
iawrasfprpraievladsirlcsvarp

SCOPe Domain Coordinates for d4y0mj1:

Click to download the PDB-style file with coordinates for d4y0mj1.
(The format of our PDB-style files is described here.)

Timeline for d4y0mj1: