Lineage for d4xq3d_ (4xq3 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2787428Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2787429Protein automated matches [190914] (14 species)
    not a true protein
  7. 2787732Species Sulfolobus solfataricus [TaxId:555311] [272009] (1 PDB entry)
  8. 2787736Domain d4xq3d_: 4xq3 D: [272012]
    automated match to d1th7b_

Details for d4xq3d_

PDB Entry: 4xq3 (more details), 2.6 Å

PDB Description: crystal structure of sso-smap2
PDB Compounds: (D:) Like-Sm ribonucleoprotein core

SCOPe Domain Sequences for d4xq3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xq3d_ b.38.1.0 (D:) automated matches {Sulfolobus solfataricus [TaxId: 555311]}
kvenplkslrtainrivlvklkdgseyigkleqtdgtmnlvlrdcteiregtsepvakyg
rvlirgsnilfisvdyetv

SCOPe Domain Coordinates for d4xq3d_:

Click to download the PDB-style file with coordinates for d4xq3d_.
(The format of our PDB-style files is described here.)

Timeline for d4xq3d_: