SCOPe 2.07: Domain d4uaob1: 4uao B:1-107

Lineage for d4uaob1 (4uao B:1-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (18 PDB entries)

8. Domain d4uaob1: 4uao B:1-107 [271997]
   Other proteins in same PDB: d4uaob2
   automated match to d1c5da1

Details for d4uaob1

PDB Entry: 4uao, 3.1 Å

PDB Description: crystal structure of apical membrane antigen 1 from plasmodium knowlesi in complex with an invasion inhibitory antibody

PDB Compounds: (B:) immunoglobulin R31C2 light chain

SCOPe Domain Sequences for d4uaob1:

Sequence; same for both SEQRES and ATOM records:

>d4uaob1 b.1.1.0 (B:1-107) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
diqmtqspssmsaslgdrvtitcqasqdignnliwfqqkpgksprrmiyyatklangvps
rfsgsrsgsdysltiislesedmadyhclqykqfpltfgsgtrleik

Timeline for d4uaob1:

• d4uaob1 first appeared in SCOPe 2.05
  
• d4uaob1 appears in SCOPe 2.06
  
• d4uaob1 appears in the current release, SCOPe 2.08