SCOPe 2.08: Domain d4wqqa1: 4wqq A:1-140

Lineage for d4wqqa1 (4wqq A:1-140)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein automated matches [190329] (10 species)
   not a true protein

7. Species Cucumaria echinata [TaxId:40245] [271988] (1 PDB entry)

8. Domain d4wqqa1: 4wqq A:1-140 [271994]
   Other proteins in same PDB: d4wqqa2, d4wqqb2, d4wqqc2, d4wqqd2
   automated match to d1wmza_
   complexed with ca, man; mutant

Details for d4wqqa1

PDB Entry: 4wqq, 1.7 Å

PDB Description: structure of epnh mutant of cel-i

PDB Compounds: (A:) lectin CEL-I, N-acetyl-D-galactosamine-specific C-type

SCOPe Domain Sequences for d4wqqa1:

Sequence; same for both SEQRES and ATOM records:

>d4wqqa1 d.169.1.1 (A:1-140) automated matches {Cucumaria echinata [TaxId: 40245]}
nqcptdweaegdhcyrffntlttwenahhecvsyscstlnvrsdlvsvhsaaeqayvfny
wrgidsqagqlwiglydkynegdfiwtdgskvgytkwaggepnnhnnaedygqfrhtegg
awndnsaaaqakymckltfe

Timeline for d4wqqa1:

• d4wqqa1 first appeared in SCOPe 2.05, called d4wqqa_
  
• d4wqqa1 appears in SCOPe 2.07