Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (30 species) not a true protein |
Species Human immunodeficiency virus type 1 bh10 [TaxId:11678] [225195] (19 PDB entries) |
Domain d4rw6a2: 4rw6 A:430-552 [271958] Other proteins in same PDB: d4rw6a1, d4rw6b_ automated match to d2ykna2 complexed with 494 |
PDB Entry: 4rw6 (more details), 2.63 Å
SCOPe Domain Sequences for d4rw6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rw6a2 c.55.3.0 (A:430-552) automated matches {Human immunodeficiency virus type 1 bh10 [TaxId: 11678]} ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd klv
Timeline for d4rw6a2: