Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
Protein automated matches [190526] (26 species) not a true protein |
Species Favia favus [TaxId:102203] [188529] (4 PDB entries) |
Domain d4p76b_: 4p76 B: [271893] Other proteins in same PDB: d4p76a2 automated match to d2dddb_ complexed with na |
PDB Entry: 4p76 (more details), 2.9 Å
SCOPe Domain Sequences for d4p76b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p76b_ d.22.1.0 (B:) automated matches {Favia favus [TaxId: 102203]} svitsemkielrmegavnghkfvitgkgsgqpfegiqnvdltvieggplpfafdilttaf hygnrvfveypeeivdyfkqsfpegyswersmsyedggiclatnnitmkkdgsncfvnei rfdgvnfpangpvmqrktvkwepstekmyvrdgvlkgdvnmalllqggghyrcdfrttyk akkvvqlpdyhfvdhsmeitshdkdynkvklyehakahsglp
Timeline for d4p76b_: