Lineage for d4p76b_ (4p76 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 2940985Species Favia favus [TaxId:102203] [188529] (4 PDB entries)
  8. 2940993Domain d4p76b_: 4p76 B: [271893]
    Other proteins in same PDB: d4p76a2
    automated match to d2dddb_
    complexed with na

Details for d4p76b_

PDB Entry: 4p76 (more details), 2.9 Å

PDB Description: cellular response to a crystal-forming protein
PDB Compounds: (B:) photoconvertible fluorescent protein

SCOPe Domain Sequences for d4p76b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p76b_ d.22.1.0 (B:) automated matches {Favia favus [TaxId: 102203]}
svitsemkielrmegavnghkfvitgkgsgqpfegiqnvdltvieggplpfafdilttaf
hygnrvfveypeeivdyfkqsfpegyswersmsyedggiclatnnitmkkdgsncfvnei
rfdgvnfpangpvmqrktvkwepstekmyvrdgvlkgdvnmalllqggghyrcdfrttyk
akkvvqlpdyhfvdhsmeitshdkdynkvklyehakahsglp

SCOPe Domain Coordinates for d4p76b_:

Click to download the PDB-style file with coordinates for d4p76b_.
(The format of our PDB-style files is described here.)

Timeline for d4p76b_: